PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G081800.1
Common NamePHAVU_003G081800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TALE
Protein Properties Length: 370aa    MW: 41527.4 Da    PI: 7.0183
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G081800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092983322155
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                         k +yps++++  LA+++gL+++q+ +WF N+R ++
  Phvul.003G081800.1 298 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 332
                         569*****************************885 PP

2ELK38.23.1e-13252272121
                 ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                         ELK qLlrKY+gyLgsLkqEF
  Phvul.003G081800.1 252 ELKGQLLRKYRGYLGSLKQEF 272
                         9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.0E-20117161IPR005540KNOX1
PfamPF037902.1E-22118157IPR005540KNOX1
SMARTSM012561.9E-25166217IPR005541KNOX2
PfamPF037911.2E-21170216IPR005541KNOX2
SMARTSM011885.9E-7252273IPR005539ELK domain
PROSITE profilePS5121311.139252272IPR005539ELK domain
PfamPF037895.7E-9252272IPR005539ELK domain
PROSITE profilePS5007113.07272335IPR001356Homeobox domain
SuperFamilySSF466891.28E-19274350IPR009057Homeodomain-like
SMARTSM003897.4E-13274339IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-28277337IPR009057Homeodomain-like
CDDcd000862.17E-12284336No hitNo description
PfamPF059206.7E-17292331IPR008422Homeobox KN domain
PROSITE patternPS000270310333IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MEGGSNEASS VMGFGENTSS SGVCPMMMMP LVTSHHGGHH PLNPNLNNPN RNPNVNTNTN  60
TLFLPMPTTT NNHHPNRNSI HDNNHNTNTS ELGYFMEIHS RNTNNNNDGS SSSSSSSAVK  120
AKIMAHPHYH RLLAAYVNCQ KVGAPPEVVA RLEEACASAA VTMAGGTARI GEDPALDQFM  180
EAYCEMLIKY EQELTKPFKE AMLFLQRIEC QFKSLTISSS DTGCNEGGDR NGSSEDIDVH  240
NNIIDPQAED QELKGQLLRK YRGYLGSLKQ EFTKKRKKGK LPKEARQQLL DWWSRHYKWP  300
YPSESQKLAL AESTGLDQKQ INNWFINQRK RHWKPSEDMQ FVVVDPSHPH YYMENVVGNP  360
FPDLSHTML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267276LKQEFTKKRK
2273277KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153990.10.0hypothetical protein PHAVU_003G081800g
SwissprotP466081e-168HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLV7C7610.0V7C761_PHAVU; Uncharacterized protein
STRINGGLYMA07G39350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-130KNOX/ELK homeobox transcription factor